Product Specifications

Purity
≥99%
Form
Lyophilized powder
Batch Tested
Yes - every batch
Mol. Weight
3357.9 g/mol
Mol. Formula
C149H246N44O42S
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
CAS Number
86168-78-7
Base SKU
PEP-SER

You are $300.00 away from free shipping.

Sermorelin

Research-grade quality - independently verified, every batch.

Starting from

Price range: $55.00 through $89.00

Select Amount, Size & Quantity

View Sample COA (PDF) ↗

Representative COA for this SKU — a batch-specific certificate is provided with fulfilled orders or on request.

  • Third-party tested — every batch
  • COA available for every lot
  • Research-grade purity ≥99%
  • Manufactured, tested, and shipped from the US
  • Secure checkout
  • HPLC & mass spec verified

Product Overview

Sermorelin is a synthetic peptide analog research compound studied in controlled laboratory environments. As a structural analog of endogenous growth hormone-releasing hormone, its well-characterized receptor interaction profile has made it a widely referenced material in releasing hormone peptide research. Researchers select Sermorelin when examining releasing hormone analog behavior, receptor binding interaction modeling, and hypothalamic peptide research under controlled conditions. Supplied as a lyophilized powder for laboratory preparation. Store dry material in a cool, dry environment away from direct light. Once reconstituted, refrigerate or freeze at -4°F for extended storage. Each batch is produced to pharmaceutical-grade standards. Strictly designated for in vitro and laboratory research use only. Not intended for human or veterinary use.

Research Use Only

This product is sold exclusively for in vitro and laboratory research purposes. Not approved for human or veterinary use. Not intended for diagnosis, treatment, or prevention of any condition. Handle in accordance with good laboratory practices.

Usage & Handling

Storage Conditions

Store at -4°F, protect from light. Refrigerate after reconstitution.

Intended Use

For in vitro and laboratory research use only

Lab Testing & Certificate of Analysis

Every batch is independently tested by an accredited third-party laboratory before it ships. COA documents are issued per lot and apply to all sizes.

View Certificate of Analysis (PDF)

Shipping & Policy

Processing Time

Orders are processed and shipped within 1–2 business days after payment clears.

Fulfilled from the U.S.

All orders ship from our U.S. fulfillment center via USPS or UPS.

Secure Packaging

All orders ship in secure, protective packaging.

Tracking Included

Tracking information is emailed automatically once your order ships.

Frequently Asked Questions

Stay in the loop.

New products, lab updates, and research resources — delivered direct.